Recombinant Saccharomyces Cerevisiae SSA1 Protein (443-642 aa), His-Myc-tagged

• Cat.No.: SSA1-2612S
• Product Overview: Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) SSA1 Protein (443-642 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 443-642 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.3 kDa
• AA Sequence: ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: SSA1
• UniProt ID: P10591