Recombinant Saccharomyces Cerevisiae POL30 Protein (1-258 aa), His-SUMO-tagged
Cat.No. : | POL30-1760S |
Product Overview : | Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) POL30 Protein (1-258 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-258 aa |
Description : | This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | POL30; PCNA; |
UniProt ID | P15873 |
◆ Recombinant Proteins | ||
POL30-1812S | Recombinant Saccharomyces Cerevisiae POL30 Protein (1-258 aa), His-tagged | +Inquiry |
POL30-1760S | Recombinant Saccharomyces Cerevisiae POL30 Protein (1-258 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POL30 Products
Required fields are marked with *
My Review for All POL30 Products
Required fields are marked with *
0
Inquiry Basket