Recombinant Saccharomyces Cerevisiae DDP1 Protein (2-188 aa), His-SUMO-tagged

• Cat.No.: DDP1-1866S
• Product Overview: Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) DDP1 Protein (2-188 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: S.cerevisiae
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 2-188 aa
• Description: May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5',5'''-P1,P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5',5'''-P1,P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate)
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 37.4 kDa
• AA Sequence: GKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKDSEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNRSAIIKDDK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: DDP1; Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase Short name: Ap6A hydrolase Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1 Diadenosine hexaphosphate hydrolase (AMP-forming)
• UniProt ID: Q99321