Recombinant Saccharomyces Cerevisiae CDA2 Protein (26-312 aa), His-tagged

• Cat.No.: CDA2-1558S
• Product Overview: Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) CDA2 Protein (26-312 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: S.cerevisiae
• Source: Yeast
• Tag: His
• Protein Length: 26-312 aa
• Description: Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.9 kDa
• AA Sequence: EANREDLKQIDFQFPVLERAATKTPFPDWLSAFTGLKEWPGLDPPYIPLDFIDFSQIPDYKEYDQNHCDSVPRDSCSFDCHHCTEHDDVYTCSKLSQTFDDGPSASTTKLLDRLKHNSTFFNLGVNIVQHPDIYQRMQKEGHLIGSHTWSHVYLPNVSNEKIIAQIEWSIWAMNATGNHTPKWFRPPYGGIDNRVRAITRQFGLQAVLWDHDTFDWSLLLNDSVITEQEILQNVINWNKSGTGLILEHDSTEKTVDLAIKINKLIGDDQSTVSHCVGGIDYIKEFLS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: CDA2
• UniProt ID: Q06703