Recombinant Saccharomyces Cerevisiae AAP1 Protein (1-389 aa), His-SUMO-tagged
Cat.No. : | AAP1-901S |
Product Overview : | Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) AAP1 Protein (1-389 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-389 aa |
Description : | Positive effector of glycogen accumulation. May be involved in nutrient-sensing. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 60.8 kDa |
AA Sequence : | MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | P37898 |
◆ Recombinant Proteins | ||
AAP1-901S | Recombinant Saccharomyces Cerevisiae AAP1 Protein (1-389 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AAP1 Products
Required fields are marked with *
My Review for All AAP1 Products
Required fields are marked with *
0
Inquiry Basket