Recombinant S. pyogenes Streptopain Protein, His-SUMO-tagged
Cat.No. : | speB-1375S |
Product Overview : | Recombinant S. pyogenes Streptopain Protein (146-398aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.pyogenes |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 146-398 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 43.6 kDa |
AA Sequence : | QPVVKSLLDSKGIHYNQGNPYNLLTPVIEKVKPGEQSFVGQHAATGCVATATAQIMKYHNYPNKGLKDYT YTLSSNNPYFNHPKNLFAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVGISVDMDYGPSSGSAGS SRVQRALKENFGYNQSVHQINRSDFSKQDWEAQIDKELSQNQPVYYQGVGKVGGHAFVIDGADGRNFYHV NWGWGGVSDGFFRLDALNPSALGTGGGAGGFNGYQSAVVGIKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Streptopain |
Official Symbol | Streptopain |
Synonyms | Streptopain; speB; EC 3.4.22.10; Exotoxin type B; SPE B; Streptococcal cysteine proteinase; Streptococcus peptidase A; SPP |
UniProt ID | P0C0J0 |
◆ Recombinant Proteins | ||
EPHA10-4314HF | Recombinant Full Length Human EPHA10 Protein, GST-tagged | +Inquiry |
MAPK12-264H | Recombinant Human MAPK12, Gly & Pro tagged | +Inquiry |
PCGF1-20HFL | Recombinant Full Length Human PCGF1 Protein, GST-tagged | +Inquiry |
SOSTDC1B-5240Z | Recombinant Zebrafish SOSTDC1B | +Inquiry |
TMEM56-4833R | Recombinant Rhesus monkey TMEM56 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
Lectin-1826P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
IgG-333T | Native Turkey IgG | +Inquiry |
Immunoglobulin E-80H | Native Human Immunoglobulin E | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGL-8979HCL | Recombinant Human AGL 293 Cell Lysate | +Inquiry |
TINF2-1060HCL | Recombinant Human TINF2 293 Cell Lysate | +Inquiry |
LOC149950-4701HCL | Recombinant Human LOC149950 293 Cell Lysate | +Inquiry |
WNT5B-292HCL | Recombinant Human WNT5B 293 Cell Lysate | +Inquiry |
TLR5-1045HCL | Recombinant Human TLR5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Streptopain Products
Required fields are marked with *
My Review for All Streptopain Products
Required fields are marked with *
0
Inquiry Basket