Recombinant S. flexneri ipaD Protein, His-SUMO/MYC-tagged
Cat.No. : | ipaD-1263S |
Product Overview : | Recombinant Shigella flexneri ipaD Protein (1-332aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.flexneri |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-332 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 56.6 kDa |
AA Sequence : | MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | ipaD invasion protein [ Shigella flexneri 5a str. M90T ] |
Official Symbol | ipaD |
Synonyms | ipaD; S0134; invasion protein; 36 kDa membrane antigen |
Gene ID | 876444 |
Protein Refseq | NP_085288.1 |
UniProt ID | P18013 |
◆ Recombinant Proteins | ||
ipaD-1263S | Recombinant S. flexneri ipaD Protein, His-SUMO/MYC-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ipaD Products
Required fields are marked with *
My Review for All ipaD Products
Required fields are marked with *
0
Inquiry Basket