Recombinant S. flexneri ipaD Protein, His-SUMO/MYC-tagged
Cat.No. : | ipaD-1263S |
Product Overview : | Recombinant Shigella flexneri ipaD Protein (1-332aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.flexneri |
Source : | E.coli |
Tag : | His&Myc&SUMO |
ProteinLength : | 1-332 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 56.6 kDa |
AA Sequence : | MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | ipaD invasion protein [ Shigella flexneri 5a str. M90T ] |
Official Symbol | ipaD |
Synonyms | ipaD; S0134; invasion protein; 36 kDa membrane antigen |
Gene ID | 876444 |
Protein Refseq | NP_085288.1 |
UniProt ID | P18013 |
◆ Native Proteins | ||
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
AGE-39 | Active Native Human Advanced Glycation End Product (AGE) Protein | +Inquiry |
DIS-2020 | Active Cyclodextrin Glucanotransferase (Powder) | +Inquiry |
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
Lectin-1776G | Active Native Galanthus Nivalis Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMK2D-7879HCL | Recombinant Human CAMK2D 293 Cell Lysate | +Inquiry |
AFG3L2-8987HCL | Recombinant Human AFG3L2 293 Cell Lysate | +Inquiry |
IYD-885HCL | Recombinant Human IYD cell lysate | +Inquiry |
CEP57-7572HCL | Recombinant Human CEP57 293 Cell Lysate | +Inquiry |
CD14-1604HCL | Recombinant Human CD14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ipaD Products
Required fields are marked with *
My Review for All ipaD Products
Required fields are marked with *
0
Inquiry Basket