Recombinant S. flexneri ADK Protein, His-SUMO/MYC-tagged
| Cat.No. : | ADK-1108S |
| Product Overview : | Recombinant full length Shigella flexneri ADK (1-214aa) protein was expressed in E. coli with N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | S. flexneri |
| Tag : | His&Myc&SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 43.6 kDa |
| AA Sequence : | MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Protein length : | 1-214 a.a. |
| Full Length : | Full L. |
| Gene Name | adenylate kinase [ Shigella flexneri 2a str. 301 ] |
| Official Symbol | ADK |
| Synonyms | Adenylate kinase; AK; EC= 2.7.4.3; ATP-AMP transphosphorylase; ADK; |
| Gene ID | 1027707 |
| Protein Refseq | NP_706367.2 |
| UniProt ID | Q83M40 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADK Products
Required fields are marked with *
My Review for All ADK Products
Required fields are marked with *
0
Inquiry Basket
