Recombinant S. enterica OmpA family protein Protein, His/MYC-tagged

• Cat.No.: OmpA-1309H
• Product Overview: Recombinant Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958 OmpA family protein Protein (82-220aa) was expressed in E. coli with N-terminal His tag and C-terminal MYC tag.

Specification

• Species: S.enterica
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 82-220 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 18.6 kDa
• AA Sequence: DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGY
  TDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: OmpA family protein
• Official Symbol: OmpA family protein
• Synonyms: OmpA family protein; OmpA
• UniProt ID: S4JJH7