Recombinant S. aureus SrtA protein, His-tagged

• Cat.No.: srtA-02S
• Product Overview: Recombinant S. aureus SrtA protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: S.aureus
• Source: E.coli
• Tag: His
• Description: Sortase belongs to a class of transpeptidases that utilize an active site cysteine thiol to modify proteins by recognizing and cleaving a carboxy-terminal sorting signal, LPXTG (where X is any amino acid), between the threonine and glycine residues. Sortase A5 is an engineered pentamutant variant of the wild-type sortase from Staphylococcus aureus that is significantly more active than the wild-type sortase. Sortase A5 site-specifically labels antibodies or proteins when the LPXTG recognition sequence is displayed. Easily attach a wide variety of labels such as peptides, DNA, carbohydrates or fluorophores containing a poly-Glycine sequence (Gly)n.
• Form: Sortase A5 protein expressed in E. coli and provided at 1 mg/ml in 50 mM HEPES pH 7.5,150 mM NaCl and 20% glycerol.
• Molecular Mass: 17.8 kDa
• AA Sequence: MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFA EENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPT AVGVLDEQKGKDKQLTLITCDDYNEETGVWETRKIFVATEVKLEHHHHHH
• Storage: Store at -80 centigrade to prevent degradation and avoid repeated freeze/thaw cycles.
• Expiry: 6 months
• Concentration: 1.0 ug/ul

Gene Information

• Gene Name: srtA class A sortase SrtA [ Staphylococcus auricularis ]
• Official Symbol: srtA
• Gene ID: 64982938
• Protein Refseq: WP_059108021.1
• UniProt ID: Q2FV99