Recombinant S. aureus SrtA protein, His-tagged
Cat.No. : | srtA-02S |
Product Overview : | Recombinant S. aureus SrtA protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.aureus |
Source : | E.coli |
Tag : | His |
Description : | Sortase belongs to a class of transpeptidases that utilize an active site cysteine thiol to modify proteins by recognizing and cleaving a carboxy-terminal sorting signal, LPXTG (where X is any amino acid), between the threonine and glycine residues. Sortase A5 is an engineered pentamutant variant of the wild-type sortase from Staphylococcus aureus that is significantly more active than the wild-type sortase. Sortase A5 site-specifically labels antibodies or proteins when the LPXTG recognition sequence is displayed. Easily attach a wide variety of labels such as peptides, DNA, carbohydrates or fluorophores containing a poly-Glycine sequence (Gly)n. |
Form : | Sortase A5 protein expressed in E. coli and provided at 1 mg/ml in 50 mM HEPES pH 7.5,150 mM NaCl and 20% glycerol. |
Molecular Mass : | 17.8 kDa |
AA Sequence : | MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFA EENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPT AVGVLDEQKGKDKQLTLITCDDYNEETGVWETRKIFVATEVKLEHHHHHH |
Storage : | Store at -80 centigrade to prevent degradation and avoid repeated freeze/thaw cycles. |
Expiry : | 6 months |
Concentration : | 1.0 ug/ul |
Gene Name | srtA class A sortase SrtA [ Staphylococcus auricularis ] |
Official Symbol | srtA |
Gene ID | 64982938 |
Protein Refseq | WP_059108021.1 |
UniProt ID | Q2FV99 |
◆ Recombinant Proteins | ||
srtA-02S | Recombinant S. aureus SrtA protein, His-tagged | +Inquiry |
srtA-1136S | Recombinant Staphylococcus aureus (strain NCTC 8325) srtA protein, His-tagged | +Inquiry |
srtA-158S | Recombinant Staphylococcus aureus srtA protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All srtA Products
Required fields are marked with *
My Review for All srtA Products
Required fields are marked with *
0
Inquiry Basket