Recombinant S. aureus SAOUHSC_01121 Protein, His-tagged
Cat.No. : | SAOUHSC_01121-1243S |
Product Overview : | Recombinant Staphylococcus aureus (strain NCTC 8325) SAOUHSC_01121 Protein (27-319aa) was expressed in Yeast with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.aureus |
Source : | Yeast |
Tag : | His |
ProteinLength : | 27-319 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 35.3 kDa |
AA Sequence : | ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | SAOUHSC_01121 alpha-hemolysin [ Staphylococcus aureus subsp. aureus NCTC 8325 ] |
Official Symbol | SAOUHSC_01121 |
Synonyms | SAOUHSC_01121; hly; Alpha-hemolysin; Alpha-HL; Alpha-toxin; hla |
Gene ID | 3920722 |
UniProt ID | Q2G1X0 |
◆ Native Proteins | ||
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
TFRC-69H | Native Human Apotransferrin | +Inquiry |
PLE-172P | Active Native Porcine Esterase | +Inquiry |
HDL-397H | Native Human High Density Lipoprotein, DiI labeled | +Inquiry |
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATA2L-1535HCL | Recombinant Human SPATA2L 293 Cell Lysate | +Inquiry |
SLPI-001HCL | Recombinant Human SLPI cell lysate | +Inquiry |
C2orf76-8063HCL | Recombinant Human C2orf76 293 Cell Lysate | +Inquiry |
FLRT3-2410HCL | Recombinant Human FLRT3 cell lysate | +Inquiry |
TRIM37-780HCL | Recombinant Human TRIM37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAOUHSC_01121 Products
Required fields are marked with *
My Review for All SAOUHSC_01121 Products
Required fields are marked with *
0
Inquiry Basket