Recombinant S. aureus NI36_RS11960 Protein, His-tagged
Cat.No. : | NI36_RS11960-1242S |
Product Overview : | Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B Protein (26-325aa) was expressed in E. coil with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.aureus |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-325 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 38.1 kDa |
AA Sequence : | AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | NI36_RS11960 gamma-hemolysin component B [ Staphylococcus aureus ] |
Official Symbol | NI36_RS11960 |
Synonyms | NI36_RS11960; gamma-hemolysin component B; hlgB |
Gene ID | 31215165 |
UniProt ID | P0A075 |
◆ Recombinant Proteins | ||
NI36_RS11960-1242S | Recombinant S. aureus NI36_RS11960 Protein, His-tagged | +Inquiry |
NI36-RS11960-0996S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS11960 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NI36_RS11960 Products
Required fields are marked with *
My Review for All NI36_RS11960 Products
Required fields are marked with *
0
Inquiry Basket