Recombinant S. aureus NI36_RS11960 Protein, His-tagged
Cat.No. : | NI36_RS11960-1242S |
Product Overview : | Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B Protein (26-325aa) was expressed in E. coil with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | 26-325 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 38.1 kDa |
AA Sequence : | AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | NI36_RS11960 gamma-hemolysin component B [ Staphylococcus aureus ] |
Official Symbol | NI36_RS11960 |
Synonyms | NI36_RS11960; gamma-hemolysin component B; hlgB |
Gene ID | 31215165 |
UniProt ID | P0A075 |
◆ Recombinant Proteins | ||
Maob-7976M | Recombinant Mouse Maob protein, His & T7-tagged | +Inquiry |
IL13-519HB | Recombinant Human IL13 protein, His-Avi-tagged, Biotinylated | +Inquiry |
DES-3303H | Recombinant Human DES protein, His-tagged | +Inquiry |
ALKBH2-4576H | Recombinant Human ALKBH2 protein, GST-tagged | +Inquiry |
PKIB-3266R | Recombinant Rhesus Macaque PKIB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
BCHE-8E | Active Native Equine Butyrylcholine esterase | +Inquiry |
Thrombin-23H | Active Native Human alpha-Thrombin | +Inquiry |
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
AGE-39 | Active Native Human Advanced Glycation End Product (AGE) Protein | +Inquiry |
LTF-175H | Native Human lactoferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS41-386HCL | Recombinant Human VPS41 293 Cell Lysate | +Inquiry |
TLR3-642MCL | Recombinant Mouse TLR3 cell lysate | +Inquiry |
ANP32C-8841HCL | Recombinant Human ANP32C 293 Cell Lysate | +Inquiry |
UTF1-449HCL | Recombinant Human UTF1 293 Cell Lysate | +Inquiry |
TRIM15-794HCL | Recombinant Human TRIM15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NI36_RS11960 Products
Required fields are marked with *
My Review for All NI36_RS11960 Products
Required fields are marked with *
0
Inquiry Basket