Recombinant Rotavirus A VP5 protein, His&Myc-tagged
Cat.No. : | VP5-4030R |
Product Overview : | Recombinant Rotavirus A VP5 protein(P35746)(247-479aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rotavirus A |
Source : | E.coli |
Tag : | His&Myc |
ProteinLength : | 247-479aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.5 kDa |
AA Sequence : | ARPNEDIIISKASLWKEVQYNRDIVIRFVFANNIIKAGGLGYKWSEISYKANNYQYTYMRDGVEVVAHTTVSVNGVSVYNYNTGPLPTDFMIRNYDVLKESSFVYVDYWDDSQAFRNMVYVRSLNAELNQVRCEGGHYSFALPVGSWPVMQGGSVILTFDGVTLSTQFTDYVSLNSLRFRFRCAVSEPSFRVTGTRISNLYGLPAANPMGDQQYYEAAGRFSLILLVPSNDDY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
HCV33709H | Recombinant Human HCV genotyp 1b (isolate Con1) NS5A(33-202) Protein | +Inquiry |
LEMD1-1516H | Recombinant Human LEMD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hps1-3435M | Recombinant Mouse Hps1 Protein, Myc/DDK-tagged | +Inquiry |
BAI3-061H | Recombinant Human BAI3 protein, GST-tagged | +Inquiry |
GPR110-3839M | Recombinant Mouse GPR110 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type IV-09H | Native Human Collagen Type IV | +Inquiry |
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
LTF-4771H | Native Human Lactotransferrin | +Inquiry |
Lectin-1808M | Active Native Maackia Amurensis Lectin I Protein, Fluorescein labeled | +Inquiry |
HP-190C | Native Dog Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGM2L1-3250HCL | Recombinant Human PGM2L1 293 Cell Lysate | +Inquiry |
C20orf107-8128HCL | Recombinant Human C20orf107 293 Cell Lysate | +Inquiry |
FANCB-593HCL | Recombinant Human FANCB cell lysate | +Inquiry |
APOA5-8787HCL | Recombinant Human APOA5 293 Cell Lysate | +Inquiry |
B31-011BCL | Borrelia burgdorferi (B31 Strain) Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VP5 Products
Required fields are marked with *
My Review for All VP5 Products
Required fields are marked with *
0
Inquiry Basket