Recombinant Rhizobium Leguminosarum NIFH Protein (1-47 aa), His-GST-Myc-tagged

• Cat.No.: NIFH-2467R
• Product Overview: Recombinant Rhizobium Leguminosarum NIFH Protein (1-47 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Species: Rhizobium Leguminosarum
• Source: E.coli
• Tag: His&GST&Myc
• ProteinLength: 1-47 aa
• Description: The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.0 kDa
• AA Sequence: MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: nifH nitrogenase iron protein [ Rhizobium leguminosarum bv. trifolii WSM2304 ]
• Official Symbol: NIFH
• Synonyms: nifH
• Gene ID: 34190633
• UniProt ID: P20623