Recombinant Rhesus monkey SERPINA1 Protein

• Cat.No.: SERPINA1-73R
• Product Overview: Recombinant Rhesus monkey SERPINA1 Protein was expressed in E. coli.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Description: The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene.
• Form: Liquid. In 20 mM Tris-HCl, 150mM NaCl, pH8.0.
• Molecular Mass: ~44.3 kDa
• AA Sequence: EDPQGDAAQKTDTSHHDQDHPTLNKITPSLAEFGFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHSEILEGLNFNVTEIPEAQVHEGFQELLHTLNKPDSQLQLTTGNGLFLNKSLKVVDKFLEDVKKLYHSEAFSVNFEDTEEAKKQINNYVEKETQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFDVEATKEEDFHVDQATTVKVPMMRRLGMFNIYHCEKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENENSRSANLHLPRLAITGTYDLKTVLGHLGITKVFSNGADLSGITEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.12 mg/ml
• Official Full Name: Serpin family A member 1

Gene Information

• Gene Name: SERPINA1 serpin family A member 1 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: SERPINA1
• Synonyms: PI; A1A; AAT; PI1; A1AT; nNIF; PRO2275; alpha1AT
• Gene ID: 701361
• mRNA Refseq: NM_001266017
• Protein Refseq: NP_001252946
• UniProt ID: F6U0C8