Recombinant Rhesus monkey LILRB4 Protein, His-tagged
Cat.No. : | LILRB4-32R |
Product Overview : | Recombinant Rhesus monkey LILRB4 Protein, fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | HEK293 |
Tag : | His |
Description : | leukocyte immunoglobulin like receptor B4 |
Form : | PBS, pH 7.4. |
Molecular Mass : | 26.36 kDa |
AA Sequence : | GPLPKPTIWAEPGSVISWGSPVTIWCQGTLDAQEYYLDKEGSPAPWDTQNPLEPRNKAKFSIPSMTQHYAGRYRCYYHSHPDWSEDSDPLDLVMTGAYSKPILSVLPSPLVTSGESVTLLCQSQSPMDTFLLFKEGAAHPLPRLRSQHGAQLHWAEFPMGPVTSVHGGTYRCISSRSFSHYLLSRPSDPVELTVLGSLESPSPSPTRSISAAGPEDQSLMPTGSDPQSGLRRHHHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.27mg/ml |
Gene Name | LILRB4 leukocyte immunoglobulin like receptor B4 [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | LILRB4 |
Synonyms | LILRBC |
Gene ID | 692336 |
mRNA Refseq | NM_001040676 |
Protein Refseq | NP_001035766 |
UniProt ID | A0A5F7ZGE5 |
◆ Recombinant Proteins | ||
LILRB4-32R | Recombinant Rhesus monkey LILRB4 Protein, His-tagged | +Inquiry |
LILRB4-316M | Recombinant Mouse LILRB4 protein, Fc-tagged | +Inquiry |
LILRB4-15HB | Recombinant Human LILRB4 protein, His-tagged, Biotinylated | +Inquiry |
LILRB4-721H | Recombinant Human LILRB4 | +Inquiry |
LILRB4-392C | Recombinant Cynomolgus LILRB4 protein, Mouse IgG2a Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB4-380HCL | Recombinant Human LILRB4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LILRB4 Products
Required fields are marked with *
My Review for All LILRB4 Products
Required fields are marked with *
0
Inquiry Basket