Recombinant Rhesus Monkey CD70 Protein, his-tagged
| Cat.No. : | CD70-01H |
| Product Overview : | Recombinant Rhesus Monkey CD70 Protein with N-terminal his6 fusion tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells. |
| Source : | HEK293 |
| Species : | Rhesus Monkey |
| Tag : | His |
| Form : | Buffered aqueous solution |
| Molecular Mass : | 17.5 kDa |
| Protein length : | 157 |
| AA Sequence : | HHHHHHAQQQLPLESLGWDIAELQLNHTGPQQDPRLYWQGGPALGRSFLRGPELDKGQLRIRRDGIYMVHIQVTLAICSSTSTSRHHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
| Endotoxin : | ＜1EU/ug by LAL |
| Purity : | ＞95% by SDS-PAGE |
| Applications : | ELISA, WB, Immunogen |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.7 mg/ml |
| Storage Buffer : | Solution in PBS, pH 7.4 |
| Gene Name | CD70 |
| Official Symbol | CD70 |
| Synonyms | CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A |
| Gene ID | 970 |
| mRNA Refseq | U78091.1 |
| Protein Refseq | XP_001088935.3 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD70 Products
Required fields are marked with *
My Review for All CD70 Products
Required fields are marked with *
0
Inquiry Basket
