Recombinant Rhesus IL6 protein
Cat.No. : | IL6-560R |
Product Overview : | Recombinant Rhesus IL6 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | Non |
Protein Length : | 186 |
Description : | Interleukin-6 (IL-6) is an interleukin that is encoded by the IL-6 gene and acts as both a pro-inflammatory and anti-inflammatory cytokine. It is secreted by T cells and macrophages to stimulate immune response. Furthermore, It plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It also induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. The rhesus macaque IL-6 contains 186 amino acids and it signals through a cell-surface type I cytokine receptor complex consisting of the ligand-binding IL-6Rα chain (CD126), and the signal- transducing component gp130 (also called CD130). |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 50 mM Tris-HCl, pH9.0, 600 mM NaCl, with 0.02 % Tween-20. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay usingIL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg. |
Molecular Mass : | Approximately 21.1 kDa, a single non-glycosylated polypeptide chain containing 186 amino acids. |
AA Sequence : | MAPVLPGEDSKNVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALRQM |
Endotoxin : | Less than 1 EU/µg of rRhIL-6 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL6 |
Official Symbol | IL6 |
Gene ID | 705819 |
mRNA Refseq | NM_001042733.2 |
Protein Refseq | NP_001036198.2 |
UniProt ID | G7MLP6 |
◆ Recombinant Proteins | ||
IL6-252H | Active Recombinant Human IL6 Protein | +Inquiry |
IL6-29S | Active Recombinant Swine IL-6 | +Inquiry |
Il6-212M | Recombinant Active Mouse IL6 Protein, His-tagged(C-ter) | +Inquiry |
Il6-076R | Recombinant Rat interleukin 6 Protein, His&Flag tagged | +Inquiry |
RPA3-2982H | Recombinant Human RPA3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
0
Inquiry Basket