Recombinant Rhesus IL3 protein

• Cat.No.: IL3-539R
• Product Overview: Recombinant Rhesus IL3 protein was expressed in Escherichia coli.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Tag: Non
• Protein Length: 124
• Description: Interleukin-3 (IL-3) is an interleukin, a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. The rhesus macaque IL-3 reported to be a monomer, as it is known, contains 124 amino acids residues which is a single non-glycosylated polypeptide. Specifically, recombinant rhesus macaque, human and murine IL-3 share low homology.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 5 % trehalose.
• Bio-activity: Assay #1: Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2 × 10⁵ IU/mg.
  Assay #2: The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg.
• Molecular Mass: Approximately 14.0 kDa, a single non-glycosylated polypeptide chain containing 124 amino acids.
• AA Sequence: APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ
• Endotoxin: Less than 1 EU/µg of rRhIL-3 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL3
• Official Symbol: IL3
• Synonyms: Hematopoietic Growth Factor, MCGF, Multipotential Colony-stimulating Factor, P-cell-stimulating Factor
• Gene ID: 706946
• mRNA Refseq: NM_001101734.1
• Protein Refseq: NP_001095204.1
• UniProt ID: P25140