Recombinant Rhesus IL1A protein

• Cat.No.: IL1A-83R
• Product Overview: Recombinant Rhesus IL1A protein was expressed in E.coli.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Tag: Non
• Protein Length: 159
• Description: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
• Form: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 10 pg/ml, corresponding to a specific activity of > 1.0 × 10⁸ IU/mg.
• Molecular Mass: Approximately 18.1 kDa, a single non-glycosylated polypeptide chain containing 159 amino acids.
• AA Sequence: SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA
• Endotoxin: Less than 0.1 EU/µg of rRhIL-1α as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL1A
• Official Symbol: IL1A
• Synonyms: IL1A; interleukin 1, alpha; IL1; interleukin-1 alpha; hematopoietin 1; IL 1A; IL1 ALPHA; IL1F1; preinterleukin 1 alpha; pro interleukin 1 alpha; IL-1 alpha; hematopoietin-1; pro-interleukin-1-alpha; IL-1A; IL1-ALPHA
• Gene ID: 700193
• mRNA Refseq: NM_001042757.1
• Protein Refseq: NP_001036222.1
• UniProt ID: P48089