Recombinant Rhesus IL1A protein
Cat.No. : | IL1A-83R |
Product Overview : | Recombinant Rhesus IL1A protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | Non |
Protein Length : | 159 |
Description : | Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 10 pg/ml, corresponding to a specific activity of > 1.0 × 10⁸ IU/mg. |
Molecular Mass : | Approximately 18.1 kDa, a single non-glycosylated polypeptide chain containing 159 amino acids. |
AA Sequence : | SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA |
Endotoxin : | Less than 0.1 EU/µg of rRhIL-1α as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL1A |
Official Symbol | IL1A |
Synonyms | IL1A; interleukin 1, alpha; IL1; interleukin-1 alpha; hematopoietin 1; IL 1A; IL1 ALPHA; IL1F1; preinterleukin 1 alpha; pro interleukin 1 alpha; IL-1 alpha; hematopoietin-1; pro-interleukin-1-alpha; IL-1A; IL1-ALPHA |
Gene ID | 700193 |
mRNA Refseq | NM_001042757.1 |
Protein Refseq | NP_001036222.1 |
UniProt ID | P48089 |
◆ Recombinant Proteins | ||
Il1a-4532G | Recombinant Golden hamster Il1a protein, His&Strep II-tagged | +Inquiry |
IL1A-05H | Recombinant Human IL1A(Ser113-Ala271) Protein, C-Avi-tagged, Biotinylated | +Inquiry |
IL1a-92M | Recombinant Mouse IL-1 alpha | +Inquiry |
IL1A-2687R | Recombinant Rat IL1A Protein, His (Fc)-Avi-tagged | +Inquiry |
ACADVL-9271H | Recombinant Human ACADVL protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1A Products
Required fields are marked with *
My Review for All IL1A Products
Required fields are marked with *
0
Inquiry Basket