Recombinant Rhesus CCL11 protein

• Cat.No.: CCL11-221R
• Product Overview: Recombinant Rhesus CCL11 protein was expressed in E.coli.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Tag: Non
• ProteinLength: 74
• Description: In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.
• Form: Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 6.9.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration range of 0.1-10.0 ng/ml.
• Molecular Mass: Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
• AA Sequence: GPDSVATTCCFTLTNKKIPLQRLESYRRIISGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKP
• Endotoxin: Less than 0.1 EU/μg of rRhEotaxin/CCL11 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CCL11
• Official Symbol: CCL11
• Synonyms: SCYA11; Eotaxin
• Gene ID: 574218
• mRNA Refseq: NM_001032874.1
• Protein Refseq: NP_001028046.1
• UniProt ID: Q8MIT7