Recombinant Rat Ccl11 protein

• Cat.No.: Ccl11-636R
• Product Overview: Recombinant Rat Ccl11 protein was expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 74
• Description: CCL11 encoded by the gene CCL11is belonging to the CC chemokine family. It is a potent eosinophil chemoattractant that was originally purified from bronchoalveolar lavage fluid of guinea pigs sensitized by aerosol challenge with ovalbumin. CCL11 is a strong and specific eosinophil chemoattractant in vitro. It can directly chemotactic for eosinophils, but not for monocytes or neutrophils. CCR3 has been identified to be a specific CCL11 receptor. CCR3 has also been shown to serve as a cofactor for a restricted subset of primary HIV viruses and binding of CCL11 to CCR3 inhibited infection by the HIV isolates.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 0.1-1.0 μg/ml.
• Molecular Mass: Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
• AA Sequence: HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP
• Endotoxin: Less than 1 EU/μg of rRtEotaxin/CCL11 as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ccl11
• Official Symbol: Ccl11
• Synonyms: CCL11; chemokine (C-C motif) ligand 11; eotaxin; C-C motif chemokine 11; small inducible cytokine A11; small-inducible cytokine A11; eosinophil chemotactic protein; small inducible cytokine subfamily A11; Scya11
• Gene ID: 29397
• mRNA Refseq: NM_019205
• Protein Refseq: NP_062078
• UniProt ID: P97545