Recombinant Rat Xcl1 protein
Cat.No. : | Xcl1-638R |
Product Overview : | Recombinant Rat Xcl1 protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein's mouse homolog is a cytokine with chemotactic activity for lymphocytes but not for monocytes or neutrophils. |
Source : | E.coli |
Species : | Rat |
Form : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human XCR1 transfected murine BaF3 cells is less than 100 ng/ml, corresponding to a specific activity of > 1.0 × 10⁴ IU/mg. |
Molecular Mass : | Approximately 10.0 kDa, a single non-glycosylated polypeptide chain containing 93 amino acids. |
Protein length : | 93 |
AA Sequence : | VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG |
Endotoxin : | Less than 0.1 EU/μg of rRtLymphotactin/XCL1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Tag : | Non |
Gene Name | Xcl1 |
Official Symbol | Xcl1 |
Synonyms | XCL1; chemokine (C motif) ligand 1; lymphotactin; cytokine SCM-1; c motif chemokine 1; small-inducible cytokine C1; small inducible cytokine subfamily C, member 1 (lymphotactin); Ltn; Scyc1; |
Gene ID | 171371 |
mRNA Refseq | NM_134361 |
Protein Refseq | NP_599188 |
UniProt ID | P51672 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Xcl1 Products
Required fields are marked with *
My Review for All Xcl1 Products
Required fields are marked with *
0
Inquiry Basket