Recombinant Rat Xcl1 protein

• Cat.No.: Xcl1-638R
• Product Overview: Recombinant Rat Xcl1 protein was expressed in E.coli.

Specification

• Description: The protein's mouse homolog is a cytokine with chemotactic activity for lymphocytes but not for monocytes or neutrophils.
• Source: E.coli
• Species: Rat
• Form: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human XCR1 transfected murine BaF3 cells is less than 100 ng/ml, corresponding to a specific activity of > 1.0 × 10⁴ IU/mg.
• Molecular Mass: Approximately 10.0 kDa, a single non-glycosylated polypeptide chain containing 93 amino acids.
• Protein length: 93
• AA Sequence: VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG
• Endotoxin: Less than 0.1 EU/μg of rRtLymphotactin/XCL1 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: Xcl1
• Official Symbol: Xcl1
• Synonyms: XCL1; chemokine (C motif) ligand 1; lymphotactin; cytokine SCM-1; c motif chemokine 1; small-inducible cytokine C1; small inducible cytokine subfamily C, member 1 (lymphotactin); Ltn; Scyc1
• Gene ID: 171371
• mRNA Refseq: NM_134361
• Protein Refseq: NP_599188
• UniProt ID: P51672