Recombinant Rat TNFRSF4 Protein, Fc-tagged

• Cat.No.: TNFRSF4-685R
• Product Overview: Recombinant Rat TNFRSF4 protein with Fc tag was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: Fc
• Protein Length: 271
• Description: Predicted to enable tumor necrosis factor-activated receptor activity. Involved in T cell proliferation. Located in cell surface. Human ortholog(s) of this gene implicated in immunodeficiency 16. Orthologous to human TNFRSF4 (TNF receptor superfamily member 4).
• Form: Lyophilized
• Molecular Mass: 47.7 kDa
• AA Sequence: MYVWVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWRSPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Tnfrsf4 tumor necrosis factor receptor superfamily, member 4 [ Rattus norvegicus ]
• Official Symbol: TNFRSF4
• Synonyms: TNFRSF4; tumor necrosis factor receptor superfamily, member 4
• Gene ID: 25572
• mRNA Refseq: NM_013049
• Protein Refseq: NP_037181
• UniProt ID: P15725