Recombinant Rat Tlr4 Protein, 26-635aa, C-8×His tagged

• Cat.No.: TLR4-6084R
• Product Overview: Recombinant Rat TLR4 Protein (26-635aa) with C-8×His tag was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Protein Length: 26-635aa
• Description: Enables lipopolysaccharide binding activity and phosphatidylinositol 3-kinase binding activity. Involved in several processes, including detection of stimulus involved in sensory perception of pain; immune response-regulating signaling pathway; and response to steroid hormone. Located in cell surface and cytoplasm. Colocalizes with membrane raft. Used to study several diseases, including carotid stenosis; ileitis; neuropathy (multiple); obesity; and renal fibrosis. Biomarker of several diseases, including kidney failure (multiple); pancreatitis (multiple); perinatal necrotizing enterocolitis; pulpitis; and sciatic neuropathy. Human ortholog(s) of this gene implicated in several diseases, including allergic contact dermatitis (multiple); artery disease (multiple); autoimmune disease (multiple); eye disease (multiple); and lung disease (multiple). Orthologous to human TLR4 (toll like receptor 4).
• Molecular Mass: The protein has a calculated MW of 71 kDa.
• AA Sequence: NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNREDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLEELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSHHHHHHHH
• Endotoxin: <1 EU/μg by LAL
• Purity: >80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.034 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH 7.4.

Gene Information

• Gene Name: Tlr4 toll-like receptor 4 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Tlr4
• Synonyms: Tlr4; toll-like receptor 4; toll-like receptor 4; toll4; EC 3.2.2.6
• Gene ID: 29260
• mRNA Refseq: NM_019178
• Protein Refseq: NP_062051
• UniProt ID: G3V7D8