Recombinant Rat Tgfbr2 protein, His&Myc-tagged

• Cat.No.: Tgfbr2-3573R
• Product Overview: Recombinant Rat Tgfbr2 protein(P38438)(24-166aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&Myc
• Protein Length: 24-166aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.0 kDa
• AA Sequence: IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Tgfbr2 transforming growth factor, beta receptor II [ Rattus norvegicus ]
• Official Symbol: Tgfbr2
• Synonyms: TGFBR2; transforming growth factor, beta receptor II; TGF-beta receptor type-2; TGFR-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; transforming growth factor beta, receptor 2; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor beta receptor type II; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor; Tgfbr2T; TGF-beta 2
• Gene ID: 81810
• mRNA Refseq: NM_031132
• Protein Refseq: NP_112394