Recombinant Rat Tgfbr2 protein, His&Myc-tagged
Cat.No. : | Tgfbr2-2261R |
Product Overview : | Recombinant Rat Tgfbr2 protein(P38438)(24-166aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 24-166aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20 kDa |
AA Sequence : | IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tgfbr2 transforming growth factor, beta receptor II [ Rattus norvegicus ] |
Official Symbol | Tgfbr2 |
Synonyms | TGFBR2; transforming growth factor, beta receptor II; TGF-beta receptor type-2; TGFR-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; transforming growth factor beta, receptor 2; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor beta receptor type II; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor; Tgfbr2T; TGF-beta 2; |
Gene ID | 81810 |
mRNA Refseq | NM_031132 |
Protein Refseq | NP_112394 |
◆ Recombinant Proteins | ||
TGFBR2-1290H | Recombinant Human TGFBR2 Protein (L50-D159), His tagged | +Inquiry |
TGFBR2-453H | Recombinant Human TGFBR2 Protein, Fc-tagged | +Inquiry |
TGFBR2-229H | Recombinant Human TGFBR2 protein, Fc-tagged | +Inquiry |
TGFBR2-564H | Recombinant Human TGFBR2 protein, His&Myc-tagged | +Inquiry |
TGFBR2-237H | Recombinant Human TGFBR2 Protein, Ile24-Asp159, C-mFc-Avi tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR2-1291CCL | Recombinant Cynomolgus TGFBR2 cell lysate | +Inquiry |
TGFBR2-2842HCL | Recombinant Human TGFBR2 cell lysate | +Inquiry |
TGFBR2-1374RCL | Recombinant Rat TGFBR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tgfbr2 Products
Required fields are marked with *
My Review for All Tgfbr2 Products
Required fields are marked with *
0
Inquiry Basket