Recombinant Rat Tgfb1 Protein, His-SUMO-tagged
Cat.No. : | Tgfb1-1384R |
Product Overview : | Recombinant Rat Tgfb1 Protein (30-278aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 30-278 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 44.5 kDa |
AA Sequence : | LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEP EADYYAKEVTRVLMVDRNNAIYDKTKDITHSIYMFFNTSDIREAVPEPPLLSRAELRLQRFKSTVEQHVE LYQKYSNNSWRYLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNVLHVEINGI SPKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Tgfb1 transforming growth factor, beta 1 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Tgfb1 |
Synonyms | Tgfb1; Tgfb |
Gene ID | 59086 |
mRNA Refseq | NM_021578.2 |
Protein Refseq | NP_067589.1 |
UniProt ID | P17246 |
◆ Recombinant Proteins | ||
TGFB1-30773TH | Recombinant Human TGFB1 | +Inquiry |
TGFB1-6429H | Recombinant Human TGFB1 Protein (Gly316-Ser390), N-His tagged | +Inquiry |
TGFB1-528H | Recombinant Human TGFB1 Protein | +Inquiry |
TGFB1-196H | Recombinant Human TGFB1 | +Inquiry |
TGFB1-5693R | Recombinant Rat TGFB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tgfb1 Products
Required fields are marked with *
My Review for All Tgfb1 Products
Required fields are marked with *
0
Inquiry Basket