Recombinant Rat Taar1 protein, His/SUMO-tagged

• Cat.No.: Taar1-45R
• Product Overview: Recombinant Rat Taar1(1-332 aa) fused with His/SUMO tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-332 a.a.
• Description: G-protein coupled receptor that induces cAMP production in response to para-tyramine and other trace amines; also acts as a receptor for catecholamine metabolites and amphetamines.
• Form: Tris-based buffer, 50% glycerol
• AA Sequence: MHLCHNSANISHTNSNWSRDVRASLYSLISLIILTTLVGNLIVIISISHFKQLHTPTNWL LHSMAVVDFLLGCLVMPYSMVRTVEHCWYFGELFCKLHTSTDIMLSSASILHLAFISIDR YYAVCDPLRYKAKINLAAIFVMILISWSLPAVFAFGMIFLELNLEGVEELYHNQVFCLRG CFPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRANLQVGLEGESRAPQ SKETKAAKTLGIMVGVFLLCWCPFFFCMVLDPFLGYVIPPTLNDTLNWFGYLNSAFNPMV YAFFYPWFRRALKMVLFGKIFQKDSSRSKLFL
• Storage: Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
  Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.

Gene Information

• Gene Name: Taar1 trace-amine-associated receptor 1 [ Rattus norvegicus ]
• Official Symbol: Taar1
• Synonyms: TAAR1; trace-amine-associated receptor 1; trace amine-associated receptor 1; Tar1; Trar1; taR-1
• Gene ID: 113914
• mRNA Refseq: NM_134328
• Protein Refseq: NP_599155
• UniProt ID: Q923Y9
• Chromosome Location: 1p12
• Pathway: Amine ligand-binding receptors, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem
• Function: G-protein coupled amine receptor activity; receptor activity; signal transducer activity; trace-amine receptor activity; trace-amine receptor activity