Recombinant Rat Taar1 protein, His/SUMO-tagged
Cat.No. : | Taar1-45R |
Product Overview : | Recombinant Rat Taar1(1-332 aa) fused with His/SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-332 a.a. |
Description : | G-protein coupled receptor that induces cAMP production in response to para-tyramine and other trace amines; also acts as a receptor for catecholamine metabolites and amphetamines. |
Form : | Tris-based buffer, 50% glycerol |
AA Sequence : | MHLCHNSANISHTNSNWSRDVRASLYSLISLIILTTLVGNLIVIISISHFKQLHTPTNWL LHSMAVVDFLLGCLVMPYSMVRTVEHCWYFGELFCKLHTSTDIMLSSASILHLAFISIDR YYAVCDPLRYKAKINLAAIFVMILISWSLPAVFAFGMIFLELNLEGVEELYHNQVFCLRG CFPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRANLQVGLEGESRAPQ SKETKAAKTLGIMVGVFLLCWCPFFFCMVLDPFLGYVIPPTLNDTLNWFGYLNSAFNPMV YAFFYPWFRRALKMVLFGKIFQKDSSRSKLFL |
Storage : | Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Gene Name | Taar1 trace-amine-associated receptor 1 [ Rattus norvegicus ] |
Official Symbol | Taar1 |
Synonyms | TAAR1; trace-amine-associated receptor 1; trace amine-associated receptor 1; Tar1; Trar1; taR-1; |
Gene ID | 113914 |
mRNA Refseq | NM_134328 |
Protein Refseq | NP_599155 |
UniProt ID | Q923Y9 |
Chromosome Location | 1p12 |
Pathway | Amine ligand-binding receptors, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem; |
Function | G-protein coupled amine receptor activity; receptor activity; signal transducer activity; trace-amine receptor activity; trace-amine receptor activity; |
◆ Recombinant Proteins | ||
TAAR1-4409R | Recombinant Rhesus Macaque TAAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Taar1-45R | Recombinant Rat Taar1 protein, His/SUMO-tagged | +Inquiry |
TAAR1-4593R | Recombinant Rhesus monkey TAAR1 Protein, His-tagged | +Inquiry |
TAAR1-5548R | Recombinant Rat TAAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL3113MF | Recombinant Full Length Mouse Trace Amine-Associated Receptor 1(Taar1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Taar1 Products
Required fields are marked with *
My Review for All Taar1 Products
Required fields are marked with *
0
Inquiry Basket