Recombinant Rat Sort1 Protein, His-SUMO-tagged
Cat.No. : | Sort1-1374R |
Product Overview : | Recombinant Rat Sort1 Protein (610-754aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 610-754 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 32.5 kDa |
AA Sequence : | CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFR PENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQN SKSSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Sort1 sortilin 1 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Sort1 |
Synonyms | Nt3; Nts3; NTR3; glycoprotein 110; gp110; neurotensin receptor 3 |
Gene ID | 83576 |
mRNA Refseq | NM_031767.1 |
Protein Refseq | NP_113955.1 |
UniProt ID | O54861 |
◆ Recombinant Proteins | ||
SORT1-29618TH | Recombinant Human SORT1 protein, GST-tagged | +Inquiry |
SORT1-0722H | Recombinant Human SORT1 protein, His-tagged | +Inquiry |
SORT1-6212H | Recombinant Human SORT1 Protein (Trp50-Asp320), N-GST tagged | +Inquiry |
SORT1-4105H | Recombinant Human SORT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sort1-430M | Recombinant Mouse Sort1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sort1 Products
Required fields are marked with *
My Review for All Sort1 Products
Required fields are marked with *
0
Inquiry Basket