Recombinant Rat Sort1 Protein, His-SUMO-tagged

Cat.No. : Sort1-1374R
Product Overview : Recombinant Rat Sort1 Protein (610-754aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Rat
Tag : His&SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 32.5 kDa
AA Sequence : CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFR
PENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQN
SKSSS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Protein length : 610-754 a.a.
Gene Name Sort1 sortilin 1 [ Rattus norvegicus (Norway rat) ]
Official Symbol Sort1
Synonyms Nt3; Nts3; NTR3; glycoprotein 110; gp110; neurotensin receptor 3
Gene ID 83576
mRNA Refseq NM_031767.1
Protein Refseq NP_113955.1
UniProt ID O54861

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Sort1 Products

Required fields are marked with *

My Review for All Sort1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon