Recombinant Rat SOCS3 Protein (1-225 aa), His-tagged
Cat.No. : | SOCS3-1526R |
Product Overview : | Recombinant Rat SOCS3 Protein (1-225 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-225 aa |
Description : | SOCS family proteins form part of a classical negative feedback syst that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Ses to recognize IL6ST. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.8 kDa |
AA Sequence : | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Socs3 suppressor of cytokine signaling 3 [ Rattus norvegicus ] |
Official Symbol | SOCS3 |
Synonyms | SOCS3; Cish3; Ssi-3; Socs-3; |
Gene ID | 89829 |
mRNA Refseq | NM_053565 |
Protein Refseq | NP_446017 |
UniProt ID | O88583 |
◆ Recombinant Proteins | ||
SOCS3-6940H | Recombinant Human Suppressor Of Cytokine Signaling 3, Myc-DDK-tagged | +Inquiry |
SOCS3-2068H | Recombinant Human SOCS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOCS3-6168C | Recombinant Chicken SOCS3 | +Inquiry |
SOCS3-5324R | Recombinant Rat SOCS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOCS3-1793HFL | Recombinant Full Length Human SOCS3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOCS3-1580HCL | Recombinant Human SOCS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOCS3 Products
Required fields are marked with *
My Review for All SOCS3 Products
Required fields are marked with *
0
Inquiry Basket