Recombinant Rat Sncg protein, His-tagged
Cat.No. : | Sncg-4565R |
Product Overview : | Recombinant Rat Sncg protein(Q63544)(1-123aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Rat |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.1 kDa |
Protein length : | 1-123aa |
AA Sequence : | MDVFKKGFSIAREGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKGERGTSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEEGEEAKSGGD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Sncg synuclein, gamma (breast cancer-specific protein 1) [ Rattus norvegicus ] |
Official Symbol | Sncg |
Synonyms | SNCG; synuclein, gamma (breast cancer-specific protein 1); gamma-synuclein; persyn; sensory neuron synuclein; |
Gene ID | 64347 |
mRNA Refseq | NM_031688 |
Protein Refseq | NP_113876 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Sncg Products
Required fields are marked with *
My Review for All Sncg Products
Required fields are marked with *
0
Inquiry Basket