Recombinant Rat SMAD3 Protein, His tagged

• Cat.No.: SMAD3-5608R
• Product Overview: Recombinant Rat SMAD family member 3 Protein with His tag was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Description: Enables several functions, including DNA-binding transcription factor activity; RNA polymerase II transcription regulatory region sequence-specific DNA binding activity; and beta-catenin binding activity. Involved in several processes, including cell surface receptor protein serine/threonine kinase signaling pathway; positive regulation of hydrolase activity; and regulation of gene expression. Located in nucleus. Part of transcription regulator complex. Used to study pre-malignant neoplasm. Human ortholog(s) of this gene implicated in Loeys-Dietz syndrome 3; Lynch syndrome; and pancreatic cancer. Orthologous to human SMAD3 (SMAD family member 3).
• Molecular Mass: 49 kDa
• AA Sequence: HHHHHHHHMSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 50 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH 7.4
• Concentration: Target Protein ~0.2 mg/mL

Gene Information

• Gene Name: Smad3 SMAD family member 3 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: SMAD3
• Synonyms: SMAD3; SMAD family member 3; mothers against decapentaplegic homolog 3; mad3; SMAD 3; MAD homolog 3; mothers against DPP homolog 3; MAD (mothers against decapentaplegic, Drosophila) homolog 3; Madh3
• Gene ID: 25631
• mRNA Refseq: NM_013095
• Protein Refseq: NP_037227
• UniProt ID: P84025