Recombinant Rat SLC39A13 Protein (130-233 aa), His-GST-tagged

• Cat.No.: SLC39A13-1021R
• Product Overview: Recombinant Rat SLC39A13 Protein (130-233 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Rat
• Source: E.coli
• Tag: GST&His
• Protein Length: 130-233 aa
• Description: Acts as a zinc-influx transporter.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 41.2 kDa
• AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Slc39a13 solute carrier family 39 (zinc transporter), member 13 [ Rattus norvegicus ]
• Official Symbol: SLC39A13
• Synonyms: SLC39A13; ZIP-13; MGC124816
• Gene ID: 295928
• mRNA Refseq: NM_001039196
• Protein Refseq: NP_001034285
• UniProt ID: Q2M1K6