Recombinant Full Length Danio Rerio Zinc Transporter Zip13(Slc39A13) Protein, His-Tagged

• Cat.No.: RFL22778DF
• Product Overview: Recombinant Full Length Danio rerio Zinc transporter ZIP13(slc39a13) Protein (Q8AW42) (1-348aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Danio rerio (Zebrafish) (Brachydanio rerio)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length (1-348)
• AA Sequence: MMIQTAVAQAKTAPAGPGPWSIKDLVDLQYLDELMSIDNLDVWFCSLVGSIAIGLSGIFP LLVIPIEAGTALKTEAGCQKLKKLLSFAIGGLLGDVFLHLLPEAWAYTSSPGGSHRHYCT QGLWVIGGLMSFLTLEKMFPDEVGDPETKTSFQRTTSSSSDLSSQFSVSPQTNGICSNNN SDSKPKTDISPYTQPEKIKTSGYLNLLANCIDNFTHGLAVAGSFLVSRKVGFLTTFAILL HEIPHEVGDFAILLRAGFDRWKAARMQLSTALGGVLGACFALCSQSQHGAENATTWILPF TSGGFLYIALVNVVPDLLEETNPRNSLLQVLLLFSGIGVMALLSIAMD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: slc39a13
• Synonyms: slc39a13; zip13; si:by184l24.1; zgc:136440; Zinc transporter ZIP13; Solute carrier family 39 member 13; Zrt- and Irt-like protein 13; ZIP-13
• UniProt ID: Q8AW42