Recombinant Rat Scp2 protein(1-547aa), His-tagged

• Cat.No.: Scp2-809R
• Product Overview: Recombinant Rat Scp2 protein(P11915)(1-547aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 1-547aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 62.9 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MPSVALNSPRLPRVFVVGVGMTKFMKPGGENSRDYPDLAKEAGQKALADRQIPYSAVEQACVGYVYGESTCGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMAQQLVQGGLANCVLALGFEKMEKGSLGTKYSDRSNPLEKHIDVLINKYGMSACPFAPQLFGSAGKEHMETYGTKVEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEIMKSRPVFDFLTVLQCCPTSDGAAAAIVSSEEFVQKHGLQSKAVEIVAQEMVTDMPSTFEEKSVIKMVGYDMSKEAARKCYEKSGLGPSDVDVIELHDCFSTNELLTYEALGLCPEGQGGALVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGLGGAAVVTLYRMGFPEAASSFRTHQISAAPTSSAGDGFKANLIFKEIEKKLEEEGEEFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPDSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQSLQLQPDKAKL

Gene Information

• Gene Name: Scp2 sterol carrier protein 2 [ Rattus norvegicus ]
• Official Symbol: Scp2
• Synonyms: SCP2; sterol carrier protein 2; non-specific lipid-transfer protein; SCP-2; SCP-X; NSL-TP; SCP-chi; sterol carrier protein X; Sterol carrier protein 2, liver; propanoyl-CoA C-acyltransferase; SCPx; NSLIPTR
• Gene ID: 25541
• mRNA Refseq: NM_138508
• Protein Refseq: NP_612517