Recombinant Rat Scp2 protein(1-547aa), His-tagged
Cat.No. : | Scp2-809R |
Product Overview : | Recombinant Rat Scp2 protein(P11915)(1-547aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-547aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 62.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MPSVALNSPRLPRVFVVGVGMTKFMKPGGENSRDYPDLAKEAGQKALADRQIPYSAVEQACVGYVYGESTCGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMAQQLVQGGLANCVLALGFEKMEKGSLGTKYSDRSNPLEKHIDVLINKYGMSACPFAPQLFGSAGKEHMETYGTKVEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEIMKSRPVFDFLTVLQCCPTSDGAAAAIVSSEEFVQKHGLQSKAVEIVAQEMVTDMPSTFEEKSVIKMVGYDMSKEAARKCYEKSGLGPSDVDVIELHDCFSTNELLTYEALGLCPEGQGGALVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGLGGAAVVTLYRMGFPEAASSFRTHQISAAPTSSAGDGFKANLIFKEIEKKLEEEGEEFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPDSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQSLQLQPDKAKL |
Gene Name | Scp2 sterol carrier protein 2 [ Rattus norvegicus ] |
Official Symbol | Scp2 |
Synonyms | SCP2; sterol carrier protein 2; non-specific lipid-transfer protein; SCP-2; SCP-X; NSL-TP; SCP-chi; sterol carrier protein X; Sterol carrier protein 2, liver; propanoyl-CoA C-acyltransferase; SCPx; NSLIPTR; |
Gene ID | 25541 |
mRNA Refseq | NM_138508 |
Protein Refseq | NP_612517 |
◆ Recombinant Proteins | ||
Scp2-2045M | Recombinant Mouse Scp2 Protein, His&GST-tagged | +Inquiry |
SCP2-1239H | Recombinant Human SCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Scp2-809R | Recombinant Rat Scp2 protein(1-547aa), His-tagged | +Inquiry |
SCP2-5275R | Recombinant Rat SCP2 Protein | +Inquiry |
SCP2-2477H | Recombinant Human SCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCP2-2023HCL | Recombinant Human SCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Scp2 Products
Required fields are marked with *
My Review for All Scp2 Products
Required fields are marked with *
0
Inquiry Basket