Recombinant Rat S100A4 Protein (2-101 aa), His-Myc-tagged

Cat.No. : S100A4-2599R
Product Overview : Recombinant Rat S100A4 Protein (2-101 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&Myc
Protein Length : 2-101 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 18.6 kDa
AA Sequence : ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name S100a4 S100 calcium-binding protein A4 [ Rattus norvegicus ]
Official Symbol S100A4
Synonyms S100A4; protein S100-A4; P9K; metastasin; calvasculin; 42A; 18A2; CAPL; MTS1; P9ka; PEL98; RNP9KA;
Gene ID 24615
mRNA Refseq NM_012618
Protein Refseq NP_036750
UniProt ID P05942

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All S100A4 Products

Required fields are marked with *

My Review for All S100A4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon