Recombinant Rat Rgn protein, His-SUMO-tagged

• Cat.No.: Rgn-3426R
• Product Overview: Recombinant Rat Rgn protein(Q03336)(1-299aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-299aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.9 kDa
• AA Sequence: MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIPSKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYVATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDVEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGMSAEGLLRQPDAGNIFKITGLGVKGIAPYSYAG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Rgn regucalcin (senescence marker protein-30) [ Rattus norvegicus ]
• Official Symbol: Rgn
• Synonyms: RGN; regucalcin (senescence marker protein-30); regucalcin; SMP-30; gluconolactonase; senescence marker protein 30; Rc; GNL; Reguc
• Gene ID: 25106
• mRNA Refseq: NM_031546
• Protein Refseq: NP_113734