Recombinant Rat Reg3g protein, His-tagged

• Cat.No.: Reg3g-3420R
• Product Overview: Recombinant Rat Reg3g protein(P42854)(27-174aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 27-174aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.3 kDa
• AA Sequence: EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Reg3g regenerating islet-derived 3 gamma [ Rattus norvegicus ]
• Official Symbol: Reg3g
• Synonyms: REG3G; regenerating islet-derived 3 gamma; regenerating islet-derived protein 3-gamma; REG-3-gamma; reg III-gamma; pancreatitis-associated protein 3; regenerating islet-derived protein 3 gamma; regenerating islet-derived protein III-gamma; Pap3; PAPIII
• Gene ID: 24620
• mRNA Refseq: NM_173097
• Protein Refseq: NP_775120