Recombinant Human REG3G protein(27-175aa), GST-tagged

• Cat.No.: REG3G-1202H
• Product Overview: Recombinant Human REG3G protein(Q6UW15)(27-175aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: GST
• Protein length: 27-175aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.0 kDa
• AASequence: EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: REG3G regenerating islet-derived 3 gamma [ Homo sapiens ]
• Official Symbol: REG3G
• Synonyms: REG3G; regenerating islet-derived 3 gamma; regenerating islet-derived protein 3-gamma; LPPM429; PAP1B; UNQ429; PAP-1B; REG-3-gamma; reg III-gamma; regenerating gene III; pancreatitis-associated protein 1B; pancreatitis-associated protein IB; regenerating islet-derived protein III-gamma; PAPIB; PAP IB; REG-III; MGC118998; MGC118999; MGC119001
• Gene ID: 130120
• mRNA Refseq: NM_001008387
• Protein Refseq: NP_001008388
• MIM: 609933
• UniProt ID: Q6UW15