Recombinant Rat REG3G Protein (27-174 aa), His-tagged

Cat.No. : REG3G-1503R
Product Overview : Recombinant Rat REG3G Protein (27-174 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury.
Source : Yeast
Species : Rat
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 18.3 kDa
Protein length : 27-174 aa
AA Sequence : EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Reg3g regenerating islet-derived 3 gamma [ Rattus norvegicus ]
Official Symbol REG3G
Synonyms REG3G; REG-3-gamma; reg III-gamma; Pap3; PAPIII;
Gene ID 24620
mRNA Refseq NM_173097
Protein Refseq NP_775120
UniProt ID P42854

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All REG3G Products

Required fields are marked with *

My Review for All REG3G Products

Required fields are marked with *

0

Inquiry Basket

cartIcon