Recombinant Rat REG3B Protein (27-175 aa), His-sumostar-tagged

• Cat.No.: REG3B-2511R
• Product Overview: Recombinant Rat REG3B Protein (27-175 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: Yeast
• Tag: His&SUMO
• Protein Length: 27-175 aa
• Description: Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 32.6 kDa
• AA Sequence: EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Reg3b regenerating family member 3 beta [ Rattus norvegicus (Norway rat) ]
• Official Symbol: REG3B
• Synonyms: Reg3b; Pap; Pap1
• Gene ID: 24618
• mRNA Refseq: NM_053289
• Protein Refseq: NP_445741
• UniProt ID: P25031