Recombinant Rat Reg3a protein, His-tagged

Cat.No. : Reg3a-3418R
Product Overview : Recombinant Rat Reg3a protein(P35231)(26-174aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 26-174aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.5 kDa
AA Sequence : EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Reg3a regenerating islet-derived 3 alpha [ Rattus norvegicus ]
Official Symbol Reg3a
Synonyms REG3A; regenerating islet-derived 3 alpha; regenerating islet-derived protein 3-alpha; REG 3; regIII; REG-3-alpha; reg III-alpha; lithostathine 3; pancreatitis-associated protein 2; islet of Langerhans regenerating protein 3; regenerating islet-derived protein 3 alpha; regenerating islet-derived protein III-alpha; Pap2; PapII;
Gene ID 171162
mRNA Refseq NM_001145846
Protein Refseq NP_001139318

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Reg3a Products

Required fields are marked with *

My Review for All Reg3a Products

Required fields are marked with *

0

Inquiry Basket

cartIcon