Recombinant Rat Reg3a protein, His-tagged

• Cat.No.: Reg3a-3418R
• Product Overview: Recombinant Rat Reg3a protein(P35231)(26-174aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 26-174aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.5 kDa
• AA Sequence: EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Reg3a regenerating islet-derived 3 alpha [ Rattus norvegicus ]
• Official Symbol: Reg3a
• Synonyms: REG3A; regenerating islet-derived 3 alpha; regenerating islet-derived protein 3-alpha; REG 3; regIII; REG-3-alpha; reg III-alpha; lithostathine 3; pancreatitis-associated protein 2; islet of Langerhans regenerating protein 3; regenerating islet-derived protein 3 alpha; regenerating islet-derived protein III-alpha; Pap2; PapII
• Gene ID: 171162
• mRNA Refseq: NM_001145846
• Protein Refseq: NP_001139318