Recombinant Rat Reg3a protein, His-tagged
Cat.No. : | Reg3a-3418R |
Product Overview : | Recombinant Rat Reg3a protein(P35231)(26-174aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Rat |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.5 kDa |
Protein length : | 26-174aa |
AA Sequence : | EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Reg3a regenerating islet-derived 3 alpha [ Rattus norvegicus ] |
Official Symbol | Reg3a |
Synonyms | REG3A; regenerating islet-derived 3 alpha; regenerating islet-derived protein 3-alpha; REG 3; regIII; REG-3-alpha; reg III-alpha; lithostathine 3; pancreatitis-associated protein 2; islet of Langerhans regenerating protein 3; regenerating islet-derived protein 3 alpha; regenerating islet-derived protein III-alpha; Pap2; PapII; |
Gene ID | 171162 |
mRNA Refseq | NM_001145846 |
Protein Refseq | NP_001139318 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Reg3a Products
Required fields are marked with *
My Review for All Reg3a Products
Required fields are marked with *
0
Inquiry Basket