| Species : |
Rat |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
46-107 a.a. |
| Description : |
CXCL7 is a small cytokine which is also an isoform of Beta-Thromboglobulin or Pro-Platelet basic protein belonging to the CXC chemokine family and it is released in large amounts from platelets following their activation. CXCL7 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. Recombinant Rat CXCL7 contains 62 amino acids which is a single non-glycosylated polypeptide chain. In addition, The rat CXCL7 shares 58 % and 77 % a.a. sequence identity with human and mouse CXCL7. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CXCR2 transfected murine BaF3 cells is in a concentration range of 0.1-1.0 ng/ml. |
| Molecular Mass : |
Approximately 6.8 kDa, a single non-glycosylated polypeptide chain containing 62 amino acids. |
| AA Sequence : |
IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI |
| Endotoxin : |
Less than 1 EU/µg of rRtNAP-2/CXCL7 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
