Recombinant Rat PLA2G5 Protein (21-137 aa), His-SUMO-tagged
Cat.No. : | PLA2G5-722R |
Product Overview : | Recombinant Rat PLA2G5 Protein (21-137 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-137 aa |
Description : | PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 29.8 kDa |
AA Sequence : | GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Pla2g5 phospholipase A2, group V [ Rattus norvegicus ] |
Official Symbol | PLA2G5 |
Synonyms | PLA2G5; PLA2-10; MGC93513; |
Gene ID | 29354 |
mRNA Refseq | NM_017174 |
Protein Refseq | NP_058870 |
UniProt ID | P51433 |
◆ Recombinant Proteins | ||
PLA2G5-1487H | Recombinant Human PLA2G5 Protein (21-138 aa), His-tagged | +Inquiry |
PLA2G5-71H | Recombinant Human Phospholipase A2, Group V, His-tagged | +Inquiry |
PLA2G5-31349TH | Recombinant Human PLA2G5, His-tagged | +Inquiry |
PLA2G5-5325C | Recombinant Chicken PLA2G5 | +Inquiry |
PLA2G5-161H | Recombinant Human PLA2G5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA2G5 Products
Required fields are marked with *
My Review for All PLA2G5 Products
Required fields are marked with *
0
Inquiry Basket