Recombinant Rat PLA2G5 Protein (21-137 aa), His-SUMO-tagged

• Cat.No.: PLA2G5-722R
• Product Overview: Recombinant Rat PLA2G5 Protein (21-137 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 21-137 aa
• Description: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 29.8 kDa
• AA Sequence: GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Pla2g5 phospholipase A2, group V [ Rattus norvegicus ]
• Official Symbol: PLA2G5
• Synonyms: PLA2G5; PLA2-10; MGC93513
• Gene ID: 29354
• mRNA Refseq: NM_017174
• Protein Refseq: NP_058870
• UniProt ID: P51433