Recombinant Rat Pla2g2a protein, His-tagged

Cat.No. : Pla2g2a-5436R
Product Overview : Recombinant Rat Pla2g2a protein(P14423)(22-146aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 22-146aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.0 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC
Gene Name Pla2g2a phospholipase A2, group IIA (platelets, synovial fluid) [ Rattus norvegicus ]
Official Symbol Pla2g2a
Synonyms PLA2G2A; phospholipase A2, group IIA (platelets, synovial fluid); phospholipase A2, membrane associated; GIIC sPLA2; platelet phospholipase A2; group IIA phospholipase A2; eted enzyme type IIA phospholipase A2; phosphatidylcholine 2-acylhydrolase 2A; sPLA2;
Gene ID 29692
mRNA Refseq NM_031598
Protein Refseq NP_113786

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Pla2g2a Products

Required fields are marked with *

My Review for All Pla2g2a Products

Required fields are marked with *

0

Inquiry Basket

cartIcon