Recombinant Rat PLA2G2A Protein (22-146 aa), His-tagged

• Cat.No.: PLA2G2A-1582R
• Product Overview: Recombinant Rat PLA2G2A Protein (22-146 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Description: Thought to participate in the regulation of the phospholipid metabolism in biombranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
• Source: Yeast
• Species: Rat
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.1 kDa
• Protein length: 22-146 aa
• AA Sequence: SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Pla2g2a phospholipase A2, group IIA (platelets, synovial fluid) [ Rattus norvegicus ]
• Official Symbol: PLA2G2A
• Synonyms: PLA2G2A; group IIA phospholipase A2; sPLA2
• Gene ID: 29692
• mRNA Refseq: NM_031598
• Protein Refseq: NP_113786
• UniProt ID: P14423