Recombinant Rat NQO2 Protein (1-231 aa), His-tagged

• Cat.No.: NQO2-1673R
• Product Overview: Recombinant Rat NQO2 Protein (1-231 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• ProteinLength: 1-231 aa
• Description: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.3 kDa
• AA Sequence: MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Nqo2 NAD(P)H dehydrogenase, quinone 2 [ Rattus norvegicus ]
• Official Symbol: NQO2
• Synonyms: NQO2; QR2; quinone reductase 2; MGC94180
• Gene ID: 291084
• mRNA Refseq: NM_001004214
• Protein Refseq: NP_001004214
• UniProt ID: Q6AY80