Recombinant Rat MYBPC3 Protein (645-864 aa), His-tagged

• Cat.No.: MYBPC3-1467R
• Product Overview: Recombinant Rat MYBPC3 Protein (645-864 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Description: Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.
• Source: Yeast
• Species: Rat
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.1 kDa
• Protein length: 645-864 aa
• AA Sequence: PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Mybpc3 myosin binding protein C, cardiac [ Rattus norvegicus ]
• Official Symbol: MYBPC3
• Synonyms: MYBPC3; myosin binding protein C, cardiac; cardiac MyBP-C
• Gene ID: 295929
• mRNA Refseq: NM_001106490
• Protein Refseq: NP_001099960
• UniProt ID: P56741