Recombinant Rat MYBPC3 Protein (645-864 aa), His-tagged
Cat.No. : | MYBPC3-1467R |
Product Overview : | Recombinant Rat MYBPC3 Protein (645-864 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 645-864 aa |
Description : | Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.1 kDa |
AA Sequence : | PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Mybpc3 myosin binding protein C, cardiac [ Rattus norvegicus ] |
Official Symbol | MYBPC3 |
Synonyms | MYBPC3; myosin binding protein C, cardiac; cardiac MyBP-C; |
Gene ID | 295929 |
mRNA Refseq | NM_001106490 |
Protein Refseq | NP_001099960 |
UniProt ID | P56741 |
◆ Recombinant Proteins | ||
MYBPC3-501H | Recombinant Human MYBPC3 | +Inquiry |
MYBPC3-1467R | Recombinant Rat MYBPC3 Protein (645-864 aa), His-tagged | +Inquiry |
Mybpc3-4236M | Recombinant Mouse Mybpc3 Protein, Myc/DDK-tagged | +Inquiry |
MYBPC3-8230H | Recombinant Human MYBPC3 protein, His & GST-tagged | +Inquiry |
MYBPC3-3551H | Recombinant Human MYBPC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYBPC3 Products
Required fields are marked with *
My Review for All MYBPC3 Products
Required fields are marked with *
0
Inquiry Basket